PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 299aa    MW: 34361.1 Da    PI: 5.5319
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625045.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.2e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed+ l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
   XP_013625045.1 16 RGPWSPKEDLTLITFIQKHGHHNWRSLPKLAGLMRCGKSCRLRWINYL 63
                     89********************************************97 PP

2Myb_DNA-binding48.71.8e-1569114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++ ++ lG++ W++Ia+ ++ gRt++++k+ w+++l
   XP_013625045.1  69 RGNFSKEEEDAIIHFHQTLGNK-WSKIASFLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.8551163IPR017930Myb domain
SuperFamilySSF466891.03E-2914110IPR009057Homeodomain-like
SMARTSM007172.3E-111565IPR001005SANT/Myb domain
PfamPF002491.7E-141663IPR001005SANT/Myb domain
CDDcd001671.43E-91863No hitNo description
PROSITE profilePS5129423.79464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2667118IPR009057Homeodomain-like
SMARTSM007172.2E-1468116IPR001005SANT/Myb domain
PfamPF002492.0E-1469114IPR001005SANT/Myb domain
CDDcd001672.16E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009866Biological Processinduced systemic resistance, ethylene mediated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0071732Biological Processcellular response to nitric oxide
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGKGRAPCCD KSKVKRGPWS PKEDLTLITF IQKHGHHNWR SLPKLAGLMR CGKSCRLRWI  60
NYLRPDVKRG NFSKEEEDAI IHFHQTLGNK WSKIASFLPG RTDNEIKNVW NTHLKKRLFP  120
NSSSYSSISC PNDRPTEADQ KKNYAIVQEE RNSRDNESQD PPSSSHLHGK HMHTKPELDE  180
VNELHEIQLL LDHDDFDDIT SAFLQTTETL FPVQPLDSLL QTPTLTGFHN TGGATQEATE  240
PQSFDHSQPE IPCGFEETNG EFDLWSQPSP NSEEFDEWLS FMDNQTYFDD FTLFGEVCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26161187108B-MYB
1gv2_A5e-26161184105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-251611858159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-251611858159MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-26161184105C-Myb DNA-Binding Domain
1msf_C5e-26161184105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625045.10.0PREDICTED: myb-related protein 308
TrEMBLA0A078FAS20.0A0A078FAS2_BRANA; BnaC03g71080D protein
TrEMBLA0A0D3BNE80.0A0A0D3BNE8_BRAOL; Uncharacterized protein
STRINGBra030812.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56160.11e-136myb domain protein 72